OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBC3B (UBE2R2) (NM_017811) Human Mass Spec Standard

Be the first to review this product
SKU
PH307977
UBE2R2 MS Standard C13 and N15-labeled recombinant protein (NP_060281)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365460 UBE2R2 rabbit polyclonal antibody
100 ul
$310.00
LY413520 Transient overexpression lysate of ubiquitin-conjugating enzyme E2R 2 (UBE2R2) (as WB positive control) 100 ug
$436.00

Other products for "UBC3B or NM_017811"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207977
Predicted MW 27 kDa
Protein Sequence
Protein Sequence
>RC207977 representing NM_017811
Red=Cloning site Green=Tags(s)

MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPY
SPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA
NVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDL
YDDDIDDEDEEEEDADCYDDDDSGNEES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060281
RefSeq Size 4457
RefSeq ORF 714
Synonyms CDC34B; E2-CDC34B; UBC3B
Locus ID 54926
UniProt ID Q712K3
Cytogenetics 9p13.3
Summary Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation. provided by RefSeq, Jul 2008
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBC3B" proteins (4)
SKU Description Size Price
LC413520 Lyophilized UBE2R2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413520 Transient overexpression lysate of ubiquitin-conjugating enzyme E2R 2 (UBE2R2) (as WB positive control) 100 ug
$436.00
TP307977 Recombinant protein of human ubiquitin-conjugating enzyme E2R 2 (UBE2R2), 20 µg 20 ug
$867.00
TP720963 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2R 2 (UBE2R2) 10 ug
$190.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products