OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPART (NM_015087) Human Mass Spec Standard

Be the first to review this product
SKU
PH307971
SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_055902)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA311430 Goat Anti-SPG20 / SPARTIN Antibody
100 ug
$565.00
LY402406 Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SPART or NM_015087"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207971
Predicted MW 72.9 kDa
Protein Sequence
Protein Sequence
>RC207971 protein sequence
Red=Cloning site Green=Tags(s)

MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTG
WESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAE
VNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPP
LETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVP
DRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI
PGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELHEWS
EKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKV
SQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAA
KCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQI
VDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055902
RefSeq Size 5031
RefSeq ORF 1998
Synonyms SPG20; TAHCCP1
Locus ID 23111
UniProt ID Q8N0X7
Cytogenetics 13q13.3
Summary This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified. Mutations associated with this gene cause autosomal recessive spastic paraplegia 20 (Troyer syndrome). provided by RefSeq, Nov 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPART" proteins (15)
SKU Description Size Price
PH327155 SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135766) 10 ug
$3,360.00
PH327162 SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135767) 10 ug
$3,360.00
PH327169 SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135768) 10 ug
$3,360.00
LC402406 Lyophilized SPG20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428017 Lyophilized SPG20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428018 Lyophilized SPG20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428019 Lyophilized SPG20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402406 Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428017 Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY428018 Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY428019 Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP307971 Recombinant protein of human spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1, 20 µg 20 ug
$737.00
TP327155 Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4, 20 µg 20 ug
$737.00
TP327162 Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3, 20 µg 20 ug
$737.00
TP327169 Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products