OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MARCHF3 (NM_178450) Human Mass Spec Standard

Be the first to review this product
SKU
PH307968
MARCH3 MS Standard C13 and N15-labeled recombinant protein (NP_848545)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316016 Rabbit polyclonal anti-MARCH3 antibody
100 ul
$380.00
LY405925 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 3 (MARCH3) (as WB positive control) 100 ug
$436.00

Other products for "MARCHF3 or NM_178450"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207968
Predicted MW 28.3 kDa
Protein Sequence
Protein Sequence
>RC207968 representing NM_178450
Red=Cloning site Green=Tags(s)

MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPM
CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQH
EKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRL
YNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848545
RefSeq Size 1816
RefSeq ORF 759
Synonyms MARCH-III; MARCH3; RNF173
Locus ID 115123
UniProt ID Q86UD3
Cytogenetics 5q23.2
Summary This gene encodes a member of the membrane-associated RING-CH (MARCH) family. The encoded protein is an E3 ubiquitin-protein ligase that may be involved in regulation of the endosomal transport pathway. provided by RefSeq, Mar 2013
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MARCHF3" proteins (3)
SKU Description Size Price
LC405925 Lyophilized 42066 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405925 Transient overexpression lysate of membrane-associated ring finger (C3HC4) 3 (MARCH3) (as WB positive control) 100 ug
$436.00
TP307968 Recombinant protein of human membrane-associated ring finger (C3HC4) 3 (MARCH3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products