OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TOB2 (NM_016272) Human Mass Spec Standard

Be the first to review this product
SKU
PH307898
TOB2 MS Standard C13 and N15-labeled recombinant protein (NP_057356)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382693 TOB2 Rabbit polyclonal Antibody
100 ul
$410.00
LY402530 Transient overexpression lysate of transducer of ERBB2, 2 (TOB2) (as WB positive control) 100 ug
$436.00

Other products for "TOB2 or NM_016272"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207898
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC207898 protein sequence
Red=Cloning site Green=Tags(s)

MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVEL
AAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVF
VPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGG
QQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGS
GTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLAN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057356
RefSeq Size 4575
RefSeq ORF 1032
Synonyms APRO5; TOB4; TOBL; TROB2
Locus ID 10766
UniProt ID Q14106
Cytogenetics 22q13.2
Summary TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.supplied by OMIM, Apr 2004
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TOB2" proteins (3)
SKU Description Size Price
LC402530 Lyophilized TOB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402530 Transient overexpression lysate of transducer of ERBB2, 2 (TOB2) (as WB positive control) 100 ug
$436.00
TP307898 Purified recombinant protein of Homo sapiens transducer of ERBB2, 2 (TOB2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products