OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CROT (NM_021151) Human Mass Spec Standard

Be the first to review this product
SKU
PH307888
CROT MS Standard C13 and N15-labeled recombinant protein (NP_066974)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349832 Rabbit Polyclonal Anti-CROT Antibody
100 ul
$205.00
LY428407 Transient overexpression lysate of carnitine O-octanoyltransferase (CROT), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CROT or NM_021151"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207888
Predicted MW 70.2 kDa
Protein Sequence
Protein Sequence
>RC207888 protein sequence
Red=Cloning site Green=Tags(s)

MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKL
LERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWHNLNYWQLLR
KEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFRTESEGRSPNHIVVLCRGRAFVFDVIHEGC
LVTPPELLRQLTYIHKKCHSEPDGPGIAALTSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMED
SSPHVTPEDYSEIIAAILIGDPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNE
GRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFI
QLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQQKMLQAFAKH
NKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFVLSTSLVGYLRVQGVVVPMVH
NGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAFHDMIQLMNSTHL

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066974
RefSeq Size 3258
RefSeq ORF 1836
Synonyms COT
Locus ID 54677
UniProt ID Q9UKG9
Cytogenetics 7q21.12
Summary This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.provided by RefSeq, Jan 2009
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CROT" proteins (5)
SKU Description Size Price
LC412059 Lyophilized CROT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428407 Lyophilized CROT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412059 Transient overexpression lysate of carnitine O-octanoyltransferase (CROT), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428407 Transient overexpression lysate of carnitine O-octanoyltransferase (CROT), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307888 Recombinant protein of human carnitine O-octanoyltransferase (CROT), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products