OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCAF12L1 (NM_178470) Human Mass Spec Standard

Be the first to review this product
SKU
PH307832
DCAF12L1 MS Standard C13 and N15-labeled recombinant protein (NP_848565)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405936 Transient overexpression lysate of DDB1 and CUL4 associated factor 12-like 1 (DCAF12L1) (as WB positive control) 100 ug
$436.00

Other products for "DCAF12L1 or NM_178470"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207832
Predicted MW 51.1 kDa
Protein Sequence
Protein Sequence
>RC207832 protein sequence
Red=Cloning site Green=Tags(s)

MAQQQTGSRKRKAPAVEAGAESSPSQGLAAADGEGPLLLKRQRRPATYRSMAHYLKVREVGGWGPARLQG
FDGELRGYAVQRLPELLTERQLELGTVNKVFASQWLNSRQVVCGTKCNTLFVVDVESGHIARIPLLRDSE
ARLAQDQQGCGIHAIELNPSKTLLATGGENPNSLAIYQLPSLDPLCLGDRHGHKDWIFAVAWLSDTVAVS
GSRDGTVALWRMDPDKFDDTVAWHSEVGLPVYAHIRPRDVEAIPRAIINPSNRKVRALACGGKNQELGAV
SLDGYFHLWKAGSALSRLLSIRLPYFRDNVCLTYCDDMSVYAVGSHSHVSFLDLRQDQQNIRPLCSREGG
TGVRSLSFYRHIITVGTGQGSLLFYDVRAQKFLEERASATLESSSGPARRKLRLACGRGWLNHNDFWVNY
FGGMEVFPNALYTHCYNWPEMKLFVAGGPLPAGLHGNYAGLWS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848565
RefSeq Size 3403
RefSeq ORF 1389
Synonyms KIAA1892L; WDR40B
Locus ID 139170
UniProt ID Q5VU92
Cytogenetics Xq25
Summary This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCAF12L1" proteins (3)
SKU Description Size Price
LC405936 Lyophilized DCAF12L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405936 Transient overexpression lysate of DDB1 and CUL4 associated factor 12-like 1 (DCAF12L1) (as WB positive control) 100 ug
$436.00
TP307832 Recombinant protein of human WD repeat domain 40B (WDR40B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products