OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

REG3A (NM_002580) Human Mass Spec Standard

Be the first to review this product
SKU
PH307791
REG3A MS Standard C13 and N15-labeled recombinant protein (NP_002571)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351398 Rabbit Polyclonal Anti-REG3A Antibody
100 ul
$205.00
LY400917 Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "REG3A or NM_002580"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207791
Predicted MW 19.4 kDa
Protein Sequence
Protein Sequence
>RC207791 protein sequence
Red=Cloning site Green=Tags(s)

MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQK
RPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTI
SSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002571
RefSeq Size 830
RefSeq ORF 525
Synonyms HIP; HIP/PAP; INGAP; PAP; PAP-H; PAP1; PBCGF; REG-III; REG3
Locus ID 5068
UniProt ID Q06141
Cytogenetics 2p12
Summary This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.provided by RefSeq, Nov 2014
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "REG3A" proteins (14)
SKU Description Size Price
PH316966 REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620354) 10 ug
$3,360.00
PH323860 REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620355) 10 ug
$3,360.00
LC400917 Lyophilized REG3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408477 Lyophilized REG3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408478 Lyophilized REG3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430071 Lyophilized REG3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400917 Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY408477 Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY408478 Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY430071 Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307791 Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 1, 20 µg 20 ug
$737.00
TP316966 Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 3, 20 µg 20 ug
$737.00
TP323860 Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 2, 20 µg 20 ug
$737.00
TP701057 Purified recombinant protein of Human regenerating islet-derived 3 alpha (REG3A), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products