OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NAB1 (NM_005966) Human Mass Spec Standard

Be the first to review this product
SKU
PH307767
NAB1 MS Standard C13 and N15-labeled recombinant protein (NP_005957)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA802908 NAB1 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2) 100 ul
$447.00
LY401805 Transient overexpression lysate of NGFI-A binding protein 1 (EGR1 binding protein 1) (NAB1) (as WB positive control) 100 ug
$436.00

Other products for "NAB1 or NM_005966"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207767
Predicted MW 54.4 kDa
Protein Sequence
Protein Sequence
>RC207767 protein sequence
Red=Cloning site Green=Tags(s)

MAAALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMASKPLHVRRLQK
ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNAREPHLKIPKCAATTCVQSLG
QGKSDVVGSLALQSVGESRLWQGHHATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTL
PKSDLNEVKELLKTNKKLAKMIGHIFEMNDDDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAA
AQLCVKDNALLTRRDELFALARQISREVTYKYTYRTTKSKCGERDELSPKRIKVEDGFPDFQDSVQTLFQ
QARAKSEELAALSSQQPEKVMAKQMEFLCNQAGYERLQHAERRLSAGLYRQSSEEHSPNGLTSDNSDGQG
ERPLNLRMPNLQNRQPHHFVVDGELSRLYPSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005957
RefSeq Size 4499
RefSeq ORF 1461
Locus ID 4664
UniProt ID Q13506
Cytogenetics 2q32.2
Summary Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2.UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NAB1" proteins (3)
SKU Description Size Price
LC401805 Lyophilized NAB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401805 Transient overexpression lysate of NGFI-A binding protein 1 (EGR1 binding protein 1) (NAB1) (as WB positive control) 100 ug
$436.00
TP307767 Recombinant protein of human NGFI-A binding protein 1 (EGR1 binding protein 1) (NAB1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products