OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NT5M (NM_020201) Human Mass Spec Standard

Be the first to review this product
SKU
PH307737
NT5M MS Standard C13 and N15-labeled recombinant protein (NP_064586)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344802 Rabbit Polyclonal Anti-NT5M Antibody - middle region
100 ul
$585.00
LY412623 Transient overexpression lysate of 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "NT5M or NM_020201"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207737
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC207737 protein sequence
Red=Cloning site Green=Tags(s)

MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALE
DRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCP
YEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRR
LHSWADDWKAILDSKRPC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064586
RefSeq Size 1633
RefSeq ORF 684
Synonyms dNT-2; dNT2; mdN
Locus ID 56953
UniProt ID Q9NPB1
Cytogenetics 17p11.2
Summary This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. provided by RefSeq, Jul 2008
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NT5M" proteins (3)
SKU Description Size Price
LC412623 Lyophilized NT5M HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412623 Transient overexpression lysate of 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP307737 Recombinant protein of human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products