FKBP6 (NM_003602) Human Mass Spec Standard

CAT#: PH307712

FKBP6 MS Standard C13 and N15-labeled recombinant protein (NP_003593)

Product Images

Coomassie blue staining of purified FKBP6 protein (Cat# TP307712). The protein was produced from HEK293T cells transfected with FKBP6 cDNA clone (Cat# RC207712) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207712
• Predicted MW: 37.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207712 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDR
  PFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL
  DFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRALLLLRRRSAPPEE
  QHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ
  KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003593
• RefSeq Size: 1640
• RefSeq ORF: 981
• Synonyms: FKBP36
• Locus ID: 8468
• UniProt ID: O75344
• Cytogenetics: 7q11.23
• Summary: The protein encoded by this gene is a cis-trans peptidyl-prolyl isomerase that may function in immunoregulation and basic cellular processes involving protein folding and trafficking. This gene is located in a chromosomal region that is deleted in Williams-Beuren syndrome. Defects in this gene may cause male infertility. There are multiple pseudogenes for this gene located nearby on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]