OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LSAMP (NM_002338) Human Mass Spec Standard

Be the first to review this product
SKU
PH307618
LSAMP MS Standard C13 and N15-labeled recombinant protein (NP_002329)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400840 Transient overexpression lysate of limbic system-associated membrane protein (LSAMP) (as WB positive control) 100 ug
$436.00

Other products for "LSAMP or NM_002338"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207618
Predicted MW 37.4 kDa
Protein Sequence
Protein Sequence
>RC207618 protein sequence
Red=Cloning site Green=Tags(s)

MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGI
IFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSD
VTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQ
VKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNV
TEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002329
RefSeq Size 9478
RefSeq ORF 1014
Synonyms IGLON3; LAMP
Locus ID 4045
UniProt ID Q13449
Cytogenetics 3q13.31
Summary This gene encodes a member of the immunoglobulin LAMP, OBCAM and neurotrimin (IgLON) family of proteins. The encoded preproprotein is proteolytically processed to generate a neuronal surface glycoprotein. This protein may act as a selective homophilic adhesion molecule during axon guidance and neuronal growth in the developing limbic system. The encoded protein may also function as a tumor suppressor and may play a role in neuropsychiatric disorders. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. provided by RefSeq, Jan 2016
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LSAMP" proteins (4)
SKU Description Size Price
LC400840 Lyophilized LSAMP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400840 Transient overexpression lysate of limbic system-associated membrane protein (LSAMP) (as WB positive control) 100 ug
$436.00
TP307618 Recombinant protein of human limbic system-associated membrane protein (LSAMP), 20 µg 20 ug
$867.00
TP721111 Purified recombinant protein of Human limbic system-associated membrane protein (LSAMP) 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products