OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BLU (ZMYND10) (NM_015896) Human Mass Spec Standard

Be the first to review this product
SKU
PH307521
ZMYND10 MS Standard C13 and N15-labeled recombinant protein (NP_056980)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414328 Transient overexpression lysate of zinc finger, MYND-type containing 10 (ZMYND10) (as WB positive control) 100 ug
$436.00

Other products for "BLU or NM_015896"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207521
Predicted MW 50.3 kDa
Protein Sequence
Protein Sequence
>RC207521 protein sequence
Red=Cloning site Green=Tags(s)

MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPT
LVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDY
CHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRML
STHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYC
LTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQ
AIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQV
KHWEKHGKTCVLAAQGDRAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056980
RefSeq Size 1780
RefSeq ORF 1320
Synonyms BLU; CILD22; DNAAF7; FLU
Locus ID 51364
UniProt ID O75800
Cytogenetics 3p21.31
Summary This gene encodes a protein containing a MYND-type zinc finger domain that likely functions in assembly of the dynein motor. Mutations in this gene can cause primary ciliary dyskinesia. This gene is also considered a tumor suppressor gene and is often mutated, deleted, or hypermethylated and silenced in cancer cells. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BLU" proteins (3)
SKU Description Size Price
LC414328 Lyophilized ZMYND10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414328 Transient overexpression lysate of zinc finger, MYND-type containing 10 (ZMYND10) (as WB positive control) 100 ug
$436.00
TP307521 Recombinant protein of human zinc finger, MYND-type containing 10 (ZMYND10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products