OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAPPC1 (NM_021210) Human Mass Spec Standard

Be the first to review this product
SKU
PH307483
TRAPPC1 MS Standard C13 and N15-labeled recombinant protein (NP_067033)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370556 TRAPPC1 rabbit polyclonal antibody
100 ul
$310.00
LY412013 Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TRAPPC1 or NM_021210"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207483
Predicted MW 16.8 kDa
Protein Sequence
Protein Sequence
>RC207483 protein sequence
Red=Cloning site Green=Tags(s)

MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK
LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF
SARAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067033
RefSeq Size 837
RefSeq ORF 435
Synonyms BET5; MUM2
Locus ID 58485
UniProt ID Q9Y5R8
Cytogenetics 17p13.1
Summary This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRAPPC1" proteins (5)
SKU Description Size Price
LC412013 Lyophilized TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432581 Lyophilized TRAPPC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412013 Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432581 Transient overexpression lysate of trafficking protein particle complex 1 (TRAPPC1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307483 Recombinant protein of human trafficking protein particle complex 1 (TRAPPC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products