OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MPND (NM_032868) Human Mass Spec Standard

Be the first to review this product
SKU
PH307440
MPND MS Standard C13 and N15-labeled recombinant protein (NP_116257)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342484 Rabbit Polyclonal Anti-MPND Antibody
100 ul
$585.00
LY409901 Transient overexpression lysate of MPN domain containing (MPND), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MPND or NM_032868"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207440
Predicted MW 50.5 kDa
Protein Sequence
Protein Sequence
>RC207440 representing NM_032868
Red=Cloning site Green=Tags(s)

MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGAL
TRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKK
SGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRP
LGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLF
LLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHS
HPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYK
GSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS

TRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116257
RefSeq Size 1530
RefSeq ORF 1413
Locus ID 84954
UniProt ID Q8N594
Cytogenetics 19p13.3
Summary Probable protease.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MPND" proteins (3)
SKU Description Size Price
LC409901 Lyophilized MPND HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409901 Transient overexpression lysate of MPN domain containing (MPND), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307440 Recombinant protein of human MPN domain containing (MPND), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products