OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RFESD (NM_173362) Human Mass Spec Standard

Be the first to review this product
SKU
PH307317
RFESD MS Standard C13 and N15-labeled recombinant protein (NP_775498)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505809 RFESD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7) 100 ul
$447.00
LY403551 Transient overexpression lysate of Rieske (Fe-S) domain containing (RFESD), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RFESD or NM_173362"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207317
Predicted MW 17.8 kDa
Protein Sequence
Protein Sequence
>RC207317 protein sequence
Red=Cloning site Green=Tags(s)

MNLDGSAQDPEKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIE
DFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGIKQRIHTVTVDNGNIYVTLSNEPFKC
DSDFYATGDFKVIKSSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775498
RefSeq Size 2716
RefSeq ORF 471
Locus ID 317671
UniProt ID Q8TAC1
Cytogenetics 5q15
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RFESD" proteins (3)
SKU Description Size Price
LC403551 Lyophilized RFESD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403551 Transient overexpression lysate of Rieske (Fe-S) domain containing (RFESD), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307317 Recombinant protein of human Rieske (Fe-S) domain containing (RFESD), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products