OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C7orf61 (NM_001004323) Human Mass Spec Standard

Be the first to review this product
SKU
PH307300
C7orf61 MS Standard C13 and N15-labeled recombinant protein (NP_001004323)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336186 Rabbit Polyclonal Anti-C7orf61 Antibody
100 ul
$585.00
LY423725 Transient overexpression lysate of chromosome 7 open reading frame 61 (C7orf61) (as WB positive control) 100 ug
$436.00

Other products for "C7orf61 or NM_001004323"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207300
Predicted MW 23.9 kDa
Protein Sequence
Protein Sequence
>RC207300 protein sequence
Red=Cloning site Green=Tags(s)

MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLVELPKEAKPKL
GESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQSGWQMCSWKSSVSSASVSSQ
VRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001004323
RefSeq Size 1020
RefSeq ORF 618
Locus ID 402573
UniProt ID Q8IZ16
Cytogenetics 7q22.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C7orf61" proteins (3)
SKU Description Size Price
LC423725 Lyophilized C7orf61 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423725 Transient overexpression lysate of chromosome 7 open reading frame 61 (C7orf61) (as WB positive control) 100 ug
$436.00
TP307300 Recombinant protein of human hypothetical LOC402573 (LOC402573), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products