OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DHRSX (NM_145177) Human Mass Spec Standard

Be the first to review this product
SKU
PH307107
DHRSX MS Standard C13 and N15-labeled recombinant protein (NP_660160)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365290 DHRSX rabbit polyclonal antibody
100 ul
$310.00
LY408039 Transient overexpression lysate of dehydrogenase/reductase (SDR family) X-linked (DHRSX) (as WB positive control) 100 ug
$436.00

Other products for "DHRSX or NM_145177"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207107
Predicted MW 36.5 kDa
Protein Sequence
Protein Sequence
>RC207107 protein sequence
Red=Cloning site Green=Tags(s)

MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV
IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT
RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ
SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA
AVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660160
RefSeq Size 2596
RefSeq ORF 990
Synonyms CXorf11; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR7C6; SDR46C1
Locus ID 207063
UniProt ID Q8N5I4
Cytogenetics X;Y
Summary Involved in the positive regulation of starvation-induced autophagy (PubMed:25076851).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DHRSX" proteins (3)
SKU Description Size Price
LC408039 Lyophilized DHRSX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408039 Transient overexpression lysate of dehydrogenase/reductase (SDR family) X-linked (DHRSX) (as WB positive control) 100 ug
$436.00
TP307107 Recombinant protein of human dehydrogenase/reductase (SDR family) X-linked (DHRSX), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products