OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B3GALNT2 (NM_152490) Human Mass Spec Standard

Be the first to review this product
SKU
PH306913
B3GALNT2 MS Standard C13 and N15-labeled recombinant protein (NP_689703)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505973 B3GALNT2 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2) 100 ul
$447.00
LY407497 Transient overexpression lysate of beta-1,3-N-acetylgalactosaminyltransferase 2 (B3GALNT2) (as WB positive control) 100 ug
$436.00

Other products for "B3GALNT2 or NM_152490"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206913
Predicted MW 56.7 kDa
Protein Sequence
Protein Sequence
>RC206913 protein sequence
Red=Cloning site Green=Tags(s)

MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTHYDVVVGVLSARNNHELRNVI
RSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNITNPVLNQEIEAFSLSEDTSSGLP
EDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLYQAEQEEALFIARFSPPSCGVQVNKLWYKPV
EQFILPESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFLEGVEGVAGGFIYTIQ
EGDALLHNLHSRPQRLIDHIRNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFN
LLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISK
DIVKWLASNSGRLKTYQGEDVSMGIWMAAIGPKRYQDSLWLCEKTCETGMLSSPQYSPWELTELWKLKER
CGDPCRCQAR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689703
RefSeq Size 4755
RefSeq ORF 1500
Synonyms B3GalNAc-T2; MDDGA11
Locus ID 148789
UniProt ID Q8NCR0
Cytogenetics 1q42.3
Summary This gene encodes a member of the glycosyltransferase 31 family. The encoded protein synthesizes GalNAc:beta-1,3GlcNAc, a novel carbohydrate structure, on N- and O-glycans. Alternatively spliced transcript variants that encode different isoforms have been described. provided by RefSeq, Mar 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "B3GALNT2" proteins (3)
SKU Description Size Price
LC407497 Lyophilized B3GALNT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407497 Transient overexpression lysate of beta-1,3-N-acetylgalactosaminyltransferase 2 (B3GALNT2) (as WB positive control) 100 ug
$436.00
TP306913 Recombinant protein of human beta-1,3-N-acetylgalactosaminyltransferase 2 (B3GALNT2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products