OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CXorf38 (NM_144970) Human Mass Spec Standard

Be the first to review this product
SKU
PH306880
CXorf38 MS Standard C13 and N15-labeled recombinant protein (NP_659407)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408112 Transient overexpression lysate of chromosome X open reading frame 38 (CXorf38) (as WB positive control) 100 ug
$436.00

Other products for "CXorf38 or NM_144970"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206880
Predicted MW 36.7 kDa
Protein Sequence
Protein Sequence
>RC206880 protein sequence
Red=Cloning site Green=Tags(s)

MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRA
RQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLS
LINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLT
SDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLR
NNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659407
RefSeq Size 4260
RefSeq ORF 957
Locus ID 159013
UniProt ID Q8TB03
Cytogenetics Xp11.4
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CXorf38" proteins (3)
SKU Description Size Price
LC408112 Lyophilized CXorf38 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408112 Transient overexpression lysate of chromosome X open reading frame 38 (CXorf38) (as WB positive control) 100 ug
$436.00
TP306880 Recombinant protein of human chromosome X open reading frame 38 (CXorf38), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products