OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBALD1 (NM_145253) Human Mass Spec Standard

Be the first to review this product
SKU
PH306877
FAM100A MS Standard C13 and N15-labeled recombinant protein (NP_660296)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407922 Transient overexpression lysate of family with sequence similarity 100, member A (FAM100A) (as WB positive control) 100 ug
$436.00

Other products for "UBALD1 or NM_145253"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206877
Predicted MW 19 kDa
Protein Sequence
Protein Sequence
>RC206877 protein sequence
Red=Cloning site Green=Tags(s)

MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQMMCTPANTPA
TPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQ
PPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660296
RefSeq Size 1430
RefSeq ORF 531
Synonyms FAM100A; PP11303
Locus ID 124402
UniProt ID Q8TB05
Cytogenetics 16p13.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBALD1" proteins (3)
SKU Description Size Price
LC407922 Lyophilized UBALD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407922 Transient overexpression lysate of family with sequence similarity 100, member A (FAM100A) (as WB positive control) 100 ug
$436.00
TP306877 Recombinant protein of human family with sequence similarity 100, member A (FAM100A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products