UBALD1 (NM_145253) Human Mass Spec Standard

CAT#: PH306877

FAM100A MS Standard C13 and N15-labeled recombinant protein (NP_660296)

Product Images

Coomassie blue staining of purified UBALD1 protein (Cat# TP306877). The protein was produced from HEK293T cells transfected with UBALD1 cDNA clone (Cat# RC206877) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206877
• Predicted MW: 19 kDa
• Protein Sequence:
  Sequence Link

  >RC206877 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQMMCTPANTPA
  TPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQ
  PPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660296
• RefSeq Size: 1430
• RefSeq ORF: 531
• Synonyms: FAM100A; PP11303
• Locus ID: 124402
• UniProt ID: Q8TB05
• Cytogenetics: 16p13.3