OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HPD (NM_002150) Human Mass Spec Standard

Be the first to review this product
SKU
PH306860
HPD MS Standard C13 and N15-labeled recombinant protein (NP_002141)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377207 HPD Rabbit polyclonal Antibody
100 ul
$410.00
LY419503 Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "HPD or NM_002150"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206860
Predicted MW 44.9 kDa
Protein Sequence
Protein Sequence
>RC206860 protein sequence
Red=Cloning site Green=Tags(s)

MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFV
LSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYG
DTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFW
SVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH
LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEV
IQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002141
RefSeq Size 1440
RefSeq ORF 1179
Synonyms 4-HPPD; 4HPPD; GLOD3; HPPDASE; PPD
Locus ID 3242
UniProt ID P32754
Cytogenetics 12q24.31
Summary The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria (HAWK). Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2010
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism, Ubiquinone and other terpenoid-quinone biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HPD" proteins (6)
SKU Description Size Price
LC419503 Lyophilized HPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432928 Lyophilized HPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419503 Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432928 Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306860 Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), 20 µg 20 ug
$737.00
TP720550 Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2. 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products