OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNAI3 (NM_006496) Human Mass Spec Standard

Be the first to review this product
SKU
PH306850
GNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_006487)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA376636 GNAI3 Rabbit polyclonal Antibody
100 ul
$475.00
LY401948 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3) (as WB positive control) 100 ug
$436.00

Other products for "GNAI3 or NM_006496"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206850
Predicted MW 40.5 kDa
Protein Sequence
Protein Sequence
>RC206850 protein sequence
Red=Cloning site Green=Tags(s)

MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYK
VVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACF
SRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKK
WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKR
SPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKE
CGLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006487
RefSeq Size 4748
RefSeq ORF 1062
Synonyms 87U6; ARCND1
Locus ID 2773
UniProt ID P08754
Cytogenetics 1p13.3
Summary Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alpha family. Mutation in this gene, resulting in a gly40-to-arg substitution, is associated with auriculocondylar syndrome, and shown to affect downstream targets in the G protein-coupled endothelin receptor pathway. provided by RefSeq, Jun 2012
Protein Families Druggable Genome
Protein Pathways Axon guidance, Chemokine signaling pathway, Gap junction, Leukocyte transendothelial migration, Long-term depression, Melanogenesis, Progesterone-mediated oocyte maturation, Tight junction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNAI3" proteins (3)
SKU Description Size Price
LC401948 Lyophilized GNAI3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401948 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3) (as WB positive control) 100 ug
$436.00
TP306850 Recombinant protein of human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products