OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OGFOD1 (NM_018233) Human Mass Spec Standard

Be the first to review this product
SKU
PH306839
OGFOD1 MS Standard C13 and N15-labeled recombinant protein (NP_060703)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502364 OGFOD1 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4) 100 ul
$447.00
LY413213 Transient overexpression lysate of 2-oxoglutarate and iron-dependent oxygenase domain containing 1 (OGFOD1) (as WB positive control) 100 ug
$436.00

Other products for "OGFOD1 or NM_018233"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206839
Predicted MW 63.2 kDa
Protein Sequence
Protein Sequence
>RC206839 protein sequence
Red=Cloning site Green=Tags(s)

MNGKRPAEPGPARVGKKGKKEVMAEFSDAVTEETLKKQVAEAWSRRTPFSHEVIVMDMDPFLHCVIPNFI
QSQDFLEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILFEDFRSWLSDISKIDLESTID
MSCAKYEFTDALLCHDDELEGRRIAFILYLVPPWDRSMGGTLDLYSIDEHFQPKQIVKSLIPSWNKLVFF
EVSPVSFHQVSEVLSEEKSRLSISGWFHGPSLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQ
VQIQEEFEESSEILLKEFLKPEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRS
EALFLLLSNFTGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPE
PEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEEL
LTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIYYE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060703
RefSeq Size 3020
RefSeq ORF 1626
Synonyms TPA1
Locus ID 55239
UniProt ID Q8N543
Cytogenetics 16q13
Summary Prolyl 3-hydroxylase that catalyzes 3-hydroxylation of 'Pro-62' of small ribosomal subunit uS12 (RPS23), thereby regulating protein translation termination efficiency. Involved in stress granule formation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OGFOD1" proteins (3)
SKU Description Size Price
LC413213 Lyophilized OGFOD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413213 Transient overexpression lysate of 2-oxoglutarate and iron-dependent oxygenase domain containing 1 (OGFOD1) (as WB positive control) 100 ug
$436.00
TP306839 Recombinant protein of human 2-oxoglutarate and iron-dependent oxygenase domain containing 1 (OGFOD1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products