OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

METTL8 (NM_024770) Human Mass Spec Standard

Be the first to review this product
SKU
PH306824
METTL8 MS Standard C13 and N15-labeled recombinant protein (NP_079046)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA378487 METTL8 Rabbit polyclonal Antibody
100 ul
$410.00
LY411082 Transient overexpression lysate of methyltransferase like 8 (METTL8) (as WB positive control) 100 ug
$436.00

Other products for "METTL8 or NM_024770"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206824
Predicted MW 46.8 kDa
Protein Sequence
Protein Sequence
>RC206824 representing NM_024770
Red=Cloning site Green=Tags(s)

MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSA
VRVLLEEQVKYEREASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQKPEEKARESSWDHVKTSATNR
FSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKKGPMETGLFPGSNATFRILEVGCGAGNS
VFPILNTLENSPESFLYCCDFASGAVELVKSHSSYRATQCFAFVHDVCDDGLPYPFPDGILDVILLVFVL
SSIHPDRMQGVVNRLSKLLKPGGMLLFRDYGRYDKTQLRFKKGHCLSENFYVRGDGTRAYFFTKGEVHSM
FCKASLDEKQNLVDRRLQVNRKKQVKMHRVWIQGKFQKPLHQTQNSSNMVSTLLSQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079046
RefSeq Size 8154
RefSeq ORF 1221
Synonyms TIP
Locus ID 79828
UniProt ID B3KW44
Cytogenetics 2q31.1
Summary Probable methyltransferase.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "METTL8" proteins (3)
SKU Description Size Price
LC411082 Lyophilized METTL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411082 Transient overexpression lysate of methyltransferase like 8 (METTL8) (as WB positive control) 100 ug
$436.00
TP306824 Purified recombinant protein of Homo sapiens methyltransferase like 8 (METTL8), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products