OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BNIPL (NM_138278) Human Mass Spec Standard

Be the first to review this product
SKU
PH306811
BNIPL MS Standard C13 and N15-labeled recombinant protein (NP_612122)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809240 BNIPL mouse monoclonal antibody,clone OTI2E8 100 ul
$447.00
LY408738 Transient overexpression lysate of BCL2/adenovirus E1B 19kD interacting protein like (BNIPL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "BNIPL or NM_138278"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206811
Predicted MW 39.7 kDa
Protein Sequence
Protein Sequence
>RC206811 protein sequence
Red=Cloning site Green=Tags(s)

MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPEEAGTSEDPEDPKGDSQAAAG
TPSTLALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSDLEIDELETPSDSEQLDSGHE
FEWEDELPRAEGLGTSETAERLGRGCMWDVTGEDGHHWRVFRMGPREQRVDMTVIEPYKKVLSHGGYHGD
GLNAVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRT
LDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRD
LHGSGGT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612122
RefSeq Size 2160
RefSeq ORF 1071
Synonyms BNIP-S; BNIP-Salpha; BNIP-Sbeta; BNIPL-1; BNIPL-2; BNIPL1; BNIPL2; BNIPS; PP753
Locus ID 149428
UniProt ID Q7Z465
Cytogenetics 1q21.3
Summary The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. provided by RefSeq, Aug 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BNIPL" proteins (3)
SKU Description Size Price
LC408738 Lyophilized BNIPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408738 Transient overexpression lysate of BCL2/adenovirus E1B 19kD interacting protein like (BNIPL), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306811 Recombinant protein of human BCL2/adenovirus E1B 19kD interacting protein like (BNIPL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products