DNAAF6 (NM_173494) Human Mass Spec Standard

CAT#: PH306739

CXorf41 MS Standard C13 and N15-labeled recombinant protein (NP_775765)

Product Images

Coomassie blue staining of purified PIH1D3 protein (Cat# TP306739). The protein was produced from HEK293T cells transfected with PIH1D3 cDNA clone (Cat# RC206739) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206739
• Predicted MW: 24.1 kDa
• Protein Sequence:
  Sequence Link

  >RC206739 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQ
  IEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCS
  ELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDI
  ANFF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775765
• RefSeq Size: 1678
• RefSeq ORF: 642
• Synonyms: CILD36; CXorf41; NYSAR97; PIH1D3; TWISTER
• Locus ID: 139212
• UniProt ID: Q9NQM4
• Cytogenetics: Xq22.3
• Summary: Plays a role in cytoplasmic pre-assembly of axonemal dynein.[UniProtKB/Swiss-Prot Function]