OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC89 (NM_152723) Human Mass Spec Standard

Be the first to review this product
SKU
PH306650
CCDC89 MS Standard C13 and N15-labeled recombinant protein (NP_689936)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407343 Transient overexpression lysate of coiled-coil domain containing 89 (CCDC89) (as WB positive control) 100 ug
$436.00

Other products for "CCDC89 or NM_152723"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206650
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC206650 protein sequence
Red=Cloning site Green=Tags(s)

MRAPMLQKQQAPRMDTPPPEERLEKQNEKLNNQEEETEFKELDGLREALANLRGLSEEERSEKAMLRSRI
EEQSQLICILKRRSDEALERCQILELLNAELEEKMMQEAEKLKAQGEYSRKLEERFMTLAANHELMLRFK
DEYKSENIKLREENEKLRLENSSLFSQALKDEEAKVLQLTVRCEALTGELETLKERCAQDACQAQAREKE
LLELQSQQACTHTKETEQLRSQLQTLKQQHQQAVEQIAKAEETHSSLSQELQARLQTVTREKEELLQLSI
ERGKVLQNKQAEICQLEEKLEIANEDRKHALERFEQEAVAVDSNLRVRELQRKVDGIQKAYDELRLQSEA
FKKHSLDLLSKERELNGKLRHLSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689936
RefSeq Size 2428
RefSeq ORF 1122
Locus ID 220388
UniProt ID Q8N998
Cytogenetics 11q14.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC89" proteins (3)
SKU Description Size Price
LC407343 Lyophilized CCDC89 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407343 Transient overexpression lysate of coiled-coil domain containing 89 (CCDC89) (as WB positive control) 100 ug
$436.00
TP306650 Recombinant protein of human coiled-coil domain containing 89 (CCDC89), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products