OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GCAP1 (GUCA1A) (NM_000409) Human Mass Spec Standard

Be the first to review this product
SKU
PH306595
GUCA1A MS Standard C13 and N15-labeled recombinant protein (NP_000400)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336234 Rabbit Polyclonal Anti-GUCA1A Antibody
100 ul
$585.00
LY424724 Transient overexpression lysate of guanylate cyclase activator 1A (retina) (GUCA1A) (as WB positive control) 100 ug
$436.00

Other products for "GCAP1 or NM_000409"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206595
Predicted MW 22.9 kDa
Protein Sequence
Protein Sequence
>RC206595 protein sequence
Red=Cloning site Green=Tags(s)

MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY
IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVF
SKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000400
RefSeq Size 1918
RefSeq ORF 603
Synonyms GUCA1A; GUCA1ANB-GUCA1A
Locus ID 2978
UniProt ID P43080
Cytogenetics 6p21.1
Summary This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. provided by RefSeq, Jul 2020]
Protein Families Druggable Genome
Protein Pathways Olfactory transduction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GCAP1" proteins (3)
SKU Description Size Price
LC424724 Lyophilized GUCA1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424724 Transient overexpression lysate of guanylate cyclase activator 1A (retina) (GUCA1A) (as WB positive control) 100 ug
$436.00
TP306595 Recombinant protein of human guanylate cyclase activator 1A (retina) (GUCA1A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products