OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDE1B (NM_000924) Human Mass Spec Standard

Be the first to review this product
SKU
PH306588
PDE1B MS Standard C13 and N15-labeled recombinant protein (NP_000915)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503319 PDE1B mouse monoclonal antibody, clone OTI6E4 (formerly 6E4) 100 ul
$447.00
LY431450 Transient overexpression lysate of phosphodiesterase 1B, calmodulin-dependent (PDE1B), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PDE1B or NM_000924"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206588
Predicted MW 61.4 kDa
Protein Sequence
Protein Sequence
>RC206588 protein sequence
Red=Cloning site Green=Tags(s)

MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV
YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR
RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA
LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS
ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL
QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ
ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000915
RefSeq Size 3463
RefSeq ORF 1608
Synonyms HEL-S-79p; PDE1B1; PDES1B
Locus ID 5153
UniProt ID Q01064
Cytogenetics 12q13.2
Summary The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.provided by RefSeq, Jul 2011
Protein Families Druggable Genome
Protein Pathways Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDE1B" proteins (5)
SKU Description Size Price
LC400337 Lyophilized PDE1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431450 Lyophilized PDE1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400337 Transient overexpression lysate of phosphodiesterase 1B, calmodulin-dependent (PDE1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431450 Transient overexpression lysate of phosphodiesterase 1B, calmodulin-dependent (PDE1B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306588 Recombinant protein of human phosphodiesterase 1B, calmodulin-dependent (PDE1B), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products