OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Exodus 2 (CCL21) (NM_002989) Human Mass Spec Standard

Be the first to review this product
SKU
PH306579
CCL21 MS Standard C13 and N15-labeled recombinant protein (NP_002980)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349267 Rabbit Polyclonal Anti-CCL21 Antibody
100 ul
$205.00
LY401047 Transient overexpression lysate of chemokine (C-C motif) ligand 21 (CCL21) (as WB positive control) 100 ug
$436.00

Other products for "Exodus 2 or NM_002989"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206579
Predicted MW 14.6 kDa
Protein Sequence
Protein Sequence
>RC206579 protein sequence
Red=Cloning site Green=Tags(s)

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRS
QAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002980
RefSeq Size 913
RefSeq ORF 402
Synonyms 6Ckine; CKb9; ECL; SCYA21; SLC; TCA4
Locus ID 6366
UniProt ID O00585
Cytogenetics 9p13.3
Summary This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). provided by RefSeq, Sep 2014
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Exodus 2" proteins (4)
SKU Description Size Price
LC401047 Lyophilized CCL21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401047 Transient overexpression lysate of chemokine (C-C motif) ligand 21 (CCL21) (as WB positive control) 100 ug
$436.00
TP306579 Recombinant protein of human chemokine (C-C motif) ligand 21 (CCL21), 20 µg 20 ug
$867.00
TP723794 Purified recombinant protein of Human chemokine (C-C motif) ligand 21 (CCL21 / 6CKine) 10 ug
$345.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products