OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RCBTB2 (NM_001268) Human Mass Spec Standard

Be the first to review this product
SKU
PH306560
RCBTB2 MS Standard C13 and N15-labeled recombinant protein (NP_001259)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308008 Rabbit polyclonal antibody to RCBTB2 (regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2)
100 ul
$665.00
LY400508 Transient overexpression lysate of regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 (RCBTB2) (as WB positive control) 100 ug
$436.00

Other products for "RCBTB2 or NM_001268"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206560
Predicted MW 60.3 kDa
Protein Sequence
Protein Sequence
>RC206560 protein sequence
Red=Cloning site Green=Tags(s)

MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVL
GTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGL
VPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGCLQNKVVVTI
ACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYA
WGANSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHF
SCTDDVFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFR
SSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEE
NAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001259
RefSeq Size 3280
RefSeq ORF 1653
Synonyms CHC1L; RLG
Locus ID 1102
UniProt ID O95199
Cytogenetics 13q14.2
Summary This gene encodes a protein containing two C-terminal BTB/POZ domains that is related to regulator of chromosome condensation (RCC). The encoded protein may act as a guanine nucleotide exchange factor. This gene is observed to be lost or underexpressed in prostate cancers. There is a pseudogene of this gene on chromosome 10. Alternative splicing results in multiple transcript variants. provided by RefSeq, Nov 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RCBTB2" proteins (3)
SKU Description Size Price
LC400508 Lyophilized RCBTB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400508 Transient overexpression lysate of regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 (RCBTB2) (as WB positive control) 100 ug
$436.00
TP306560 Recombinant protein of human regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 (RCBTB2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products