HBZ (NM_005332) Human Mass Spec Standard
CAT#: PH306504
HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206504 |
Predicted MW | 15.6 kDa |
Protein Sequence |
>RC206504 protein sequence
Red=Cloning site Green=Tags(s) MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK YR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005323 |
RefSeq Size | 589 |
RefSeq ORF | 426 |
Synonyms | HBAZ; HBZ-T1; HBZ1 |
Locus ID | 3050 |
UniProt ID | P02008 |
Cytogenetics | 16p13.3 |
Summary | Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq, Nov 2009] |
Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417379 | HBZ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417379 | Transient overexpression lysate of hemoglobin, zeta (HBZ) |
USD 436.00 |
|
TP306504 | Recombinant protein of human hemoglobin, zeta (HBZ), 20 µg |
USD 867.00 |
|
TP720205 | Recombinant protein of human hemoglobin, zeta (HBZ) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review