OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WFDC1 (NM_021197) Human Mass Spec Standard

Be the first to review this product
SKU
PH306450
WFDC1 MS Standard C13 and N15-labeled recombinant protein (NP_067020)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA371606 WFDC1 rabbit polyclonal antibody
100 ul
$310.00
LY412036 Transient overexpression lysate of WAP four-disulfide core domain 1 (WFDC1) (as WB positive control) 100 ug
$436.00

Other products for "WFDC1 or NM_021197"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206450
Predicted MW 20.6 kDa
Protein Sequence
Protein Sequence
>RC206450 representing NM_021197
Red=Cloning site Green=Tags(s)

MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPP
RTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQ
AEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAE
PGRGQQKHFQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067020
RefSeq Size 1396
RefSeq ORF 660
Synonyms PS20
Locus ID 58189
UniProt ID Q9HC57
Cytogenetics 16q24.1
Summary This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. This gene is downregulated in many cancer types and may be involved in the inhibition of cell proliferation. The encoded protein may also play a role in the susceptibility of certain CD4 memory T cells to human immunodeficiency virus infection. Alternative splicing results in multiple transcript variants. provided by RefSeq, Sep 2013
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WFDC1" proteins (3)
SKU Description Size Price
LC412036 Lyophilized WFDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412036 Transient overexpression lysate of WAP four-disulfide core domain 1 (WFDC1) (as WB positive control) 100 ug
$436.00
TP306450 Purified recombinant protein of Homo sapiens WAP four-disulfide core domain 1 (WFDC1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products