OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXI1 (NM_144769) Human Mass Spec Standard

Be the first to review this product
SKU
PH306430
FOXI1 MS Standard C13 and N15-labeled recombinant protein (NP_658982)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800146 FOXI1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6) 100 ul
$447.00
LY402162 Transient overexpression lysate of forkhead box I1 (FOXI1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FOXI1 or NM_144769"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206430
Predicted MW 30.8 kDa
Protein Sequence
Protein Sequence
>RC206430 protein sequence
Red=Cloning site Green=Tags(s)

MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTM
TPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAP
DKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLS
PEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREG
TEV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_658982
RefSeq Size 2011
RefSeq ORF 849
Synonyms FKH10; FKHL10; FREAC-6; FREAC6; HFH-3; HFH3
Locus ID 2299
UniProt ID Q12951
Cytogenetics 5q35.1
Summary This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4. provided by RefSeq, Jan 2017
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXI1" proteins (6)
SKU Description Size Price
LC402162 Lyophilized FOXI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408109 Lyophilized FOXI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402162 Transient overexpression lysate of forkhead box I1 (FOXI1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY408109 Transient overexpression lysate of forkhead box I1 (FOXI1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306430 Recombinant protein of human forkhead box I1 (FOXI1), transcript variant 2, 20 µg 20 ug
$867.00
TP760413 Purified recombinant protein of Human forkhead box I1 (FOXI1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products