OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FGFBP2 (NM_031950) Human Mass Spec Standard

Be the first to review this product
SKU
PH306392
FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342998 Rabbit Polyclonal Anti-FGFBP2 Antibody
100 ul
$585.00
LY410396 Transient overexpression lysate of fibroblast growth factor binding protein 2 (FGFBP2) (as WB positive control) 100 ug
$436.00

Other products for "FGFBP2 or NM_031950"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206392
Predicted MW 24.6 kDa
Protein Sequence
Protein Sequence
>RC206392 protein sequence
Red=Cloning site Green=Tags(s)

MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTY
WCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPN
QQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPF
QALCAFLISFFRG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114156
RefSeq Size 1188
RefSeq ORF 669
Synonyms HBP17RP; KSP37
Locus ID 83888
UniProt ID Q9BYJ0
Cytogenetics 4p15.32
Summary This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.provided by RefSeq Staff, Oct 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FGFBP2" proteins (3)
SKU Description Size Price
LC410396 Lyophilized FGFBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410396 Transient overexpression lysate of fibroblast growth factor binding protein 2 (FGFBP2) (as WB positive control) 100 ug
$436.00
TP306392 Recombinant protein of human fibroblast growth factor binding protein 2 (FGFBP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products