FGFBP2 (NM_031950) Human Mass Spec Standard

SKU
PH306392
FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206392]
Predicted MW 24.6 kDa
Protein Sequence
Protein Sequence
>RC206392 protein sequence
Red=Cloning site Green=Tags(s)

MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTY
WCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPN
QQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPF
QALCAFLISFFRG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114156
RefSeq Size 1188
RefSeq ORF 669
Synonyms HBP17RP; KSP37
Locus ID 83888
UniProt ID Q9BYJ0
Cytogenetics 4p15.32
Summary This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.[provided by RefSeq Staff, Oct 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:FGFBP2 (NM_031950) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410396 FGFBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410396 Transient overexpression lysate of fibroblast growth factor binding protein 2 (FGFBP2) 100 ug
$436.00
TP306392 Recombinant protein of human fibroblast growth factor binding protein 2 (FGFBP2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.