OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TTC9B (NM_152479) Human Mass Spec Standard

Be the first to review this product
SKU
PH306358
TTC9B MS Standard C13 and N15-labeled recombinant protein (NP_689692)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403470 Transient overexpression lysate of tetratricopeptide repeat domain 9B (TTC9B) (as WB positive control) 100 ug
$436.00

Other products for "TTC9B or NM_152479"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206358
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC206358 protein sequence
Red=Cloning site Green=Tags(s)

MQRGALSPVLMLSAAPEPPPRPPPALSPPGSGPGSGSRHGSARPGPTPEPSGSLGAALDSSLRAAVAFKA
EGQRCYREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPTSSPGPARLSEEQRRLVESTEVECYDS
LTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRY
IQLTQLKMNRCSLQREDSGAGSQTRDVIG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689692
RefSeq Size 859
RefSeq ORF 717
Locus ID 148014
UniProt ID Q8N6N2
Cytogenetics 19q13.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TTC9B" proteins (3)
SKU Description Size Price
LC403470 Lyophilized TTC9B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403470 Transient overexpression lysate of tetratricopeptide repeat domain 9B (TTC9B) (as WB positive control) 100 ug
$436.00
TP306358 Recombinant protein of human tetratricopeptide repeat domain 9B (TTC9B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products