OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPL18 (NM_000979) Human Mass Spec Standard

Be the first to review this product
SKU
PH306317
RPL18 MS Standard C13 and N15-labeled recombinant protein (NP_000970)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY424425 Transient overexpression lysate of ribosomal protein L18 (RPL18) (as WB positive control) 100 ug
$436.00

Other products for "RPL18 or NM_000979"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206317
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC206317 protein sequence
Red=Cloning site Green=Tags(s)

MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLCLSRMIRKM
KLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLS
GPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000970
RefSeq Size 893
RefSeq ORF 564
Synonyms DBA18; L18
Locus ID 6141
UniProt ID Q07020
Cytogenetics 19q13.33
Summary Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jul 2012
Protein Pathways Ribosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RPL18" proteins (3)
SKU Description Size Price
LC424425 Lyophilized RPL18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424425 Transient overexpression lysate of ribosomal protein L18 (RPL18) (as WB positive control) 100 ug
$436.00
TP306317 Recombinant protein of human ribosomal protein L18 (RPL18), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products