OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLDND2 (NM_152353) Human Mass Spec Standard

Be the first to review this product
SKU
PH306308
CLDND2 MS Standard C13 and N15-labeled recombinant protein (NP_689566)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA352008 Rabbit Polyclonal Anti-CLDND2 Antibody
100 ul
$205.00
LY407603 Transient overexpression lysate of claudin domain containing 2 (CLDND2) (as WB positive control) 100 ug
$436.00

Other products for "CLDND2 or NM_152353"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206308
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC206308 protein sequence
Red=Cloning site Green=Tags(s)

MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAV
GVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFS
ILAGFCFLLADMIMQSTDAISGFPVCL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689566
RefSeq Size 990
RefSeq ORF 501
Locus ID 125875
UniProt ID Q8NHS1
Cytogenetics 19q13.41
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLDND2" proteins (3)
SKU Description Size Price
LC407603 Lyophilized CLDND2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407603 Transient overexpression lysate of claudin domain containing 2 (CLDND2) (as WB positive control) 100 ug
$436.00
TP306308 Recombinant protein of human claudin domain containing 2 (CLDND2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products