OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD29 (NM_173505) Human Mass Spec Standard

Be the first to review this product
SKU
PH306195
ANKRD29 MS Standard C13 and N15-labeled recombinant protein (NP_775776)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY406585 Transient overexpression lysate of ankyrin repeat domain 29 (ANKRD29) (as WB positive control) 100 ug
$436.00

Other products for "ANKRD29 or NM_173505"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206195
Predicted MW 32.5 kDa
Protein Sequence
Protein Sequence
>RC206195 protein sequence
Red=Cloning site Green=Tags(s)

MCRMSFKKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHIDCVRELVLQGA
DINLQRESGTTALFFAAQQGHNDVVRFLFGFGASTEFRTKDEGTALLAASQYGHMQVVETLLKHGANIHD
QLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRQDGTAPLWIASQMGHSEVVRVMLLRGADRDAARND
GTTALLKAANKGYNDVIKELLKFSPTLGILKNGTSALHAAVLSGNIKTVALLLEAGADPSLRNKANELPA
ELTKNERILRLLRSKEGPRKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775776
RefSeq Size 2291
RefSeq ORF 903
Locus ID 147463
UniProt ID Q8N6D5
Cytogenetics 18q11.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKRD29" proteins (3)
SKU Description Size Price
LC406585 Lyophilized ANKRD29 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406585 Transient overexpression lysate of ankyrin repeat domain 29 (ANKRD29) (as WB positive control) 100 ug
$436.00
TP306195 Recombinant protein of human ankyrin repeat domain 29 (ANKRD29), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products