OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STK38L (NM_015000) Human Mass Spec Standard

Be the first to review this product
SKU
PH306074
STK38L MS Standard C13 and N15-labeled recombinant protein (NP_055815)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505176 STK38L mouse monoclonal antibody, clone OTI4D8 (formerly 4D8) 100 ul
$447.00
LY414864 Transient overexpression lysate of serine/threonine kinase 38 like (STK38L) (as WB positive control) 100 ug
$436.00

Other products for "STK38L or NM_015000"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206074
Predicted MW 54 kDa
Protein Sequence
Protein Sequence
>RC206074 protein sequence
Red=Cloning site Green=Tags(s)

MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH
ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD
ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI
HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA
YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI
SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055815
RefSeq Size 5110
RefSeq ORF 1392
Synonyms NDR2
Locus ID 23012
UniProt ID Q9Y2H1
Cytogenetics 12p11.23
Summary Involved in the regulation of structural processes in differentiating and mature neuronal cells.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STK38L" proteins (3)
SKU Description Size Price
LC414864 Lyophilized STK38L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414864 Transient overexpression lysate of serine/threonine kinase 38 like (STK38L) (as WB positive control) 100 ug
$436.00
TP306074 Recombinant protein of human serine/threonine kinase 38 like (STK38L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products