OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNX10 (NM_013322) Human Mass Spec Standard

Be the first to review this product
SKU
PH306019
SNX10 MS Standard C13 and N15-labeled recombinant protein (NP_037454)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808896 SNX10 mouse monoclonal antibody,clone OTI6B7 100 ul
$447.00
LY415625 Transient overexpression lysate of sorting nexin 10 (SNX10) (as WB positive control) 100 ug
$436.00

Other products for "SNX10 or NM_013322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206019
Predicted MW 23.6 kDa
Protein Sequence
Protein Sequence
>RC206019 protein sequence
Red=Cloning site Green=Tags(s)

MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCVRRRYREFVWLRQRLQSNALL
VQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKY
SVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037454
RefSeq Size 2591
RefSeq ORF 603
Synonyms OPTB8
Locus ID 29887
UniProt ID Q9Y5X0
Cytogenetics 7p15.2
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene may play a role in regulating endosome homeostasis. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNX10" proteins (3)
SKU Description Size Price
LC415625 Lyophilized SNX10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415625 Transient overexpression lysate of sorting nexin 10 (SNX10) (as WB positive control) 100 ug
$436.00
TP306019 Recombinant protein of human sorting nexin 10 (SNX10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products