OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FXYD7 (NM_022006) Human Mass Spec Standard

Be the first to review this product
SKU
PH305819
FXYD7 MS Standard C13 and N15-labeled recombinant protein (NP_071289)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319936 Rabbit Polyclonal FXYD7 Antibody
100 ug
$640.00
LY411843 Transient overexpression lysate of FXYD domain containing ion transport regulator 7 (FXYD7) (as WB positive control) 100 ug
$436.00

Other products for "FXYD7 or NM_022006"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205819
Predicted MW 8.5 kDa
Protein Sequence
Protein Sequence
>RC205819 protein sequence
Red=Cloning site Green=Tags(s)

MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSEL
PSSAPGGGGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071289
RefSeq Size 713
RefSeq ORF 240
Locus ID 53822
UniProt ID P58549
Cytogenetics 19q13.12
Summary This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Dec 2000
Protein Families Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FXYD7" proteins (3)
SKU Description Size Price
LC411843 Lyophilized FXYD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411843 Transient overexpression lysate of FXYD domain containing ion transport regulator 7 (FXYD7) (as WB positive control) 100 ug
$436.00
TP305819 Recombinant protein of human FXYD domain containing ion transport regulator 7 (FXYD7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products