OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TEDC2 (NM_025108) Human Mass Spec Standard

Be the first to review this product
SKU
PH305814
C16orf59 MS Standard C13 and N15-labeled recombinant protein (NP_079384)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330767 Rabbit Polyclonal Anti-C16orf59 Antibody
100 ul
$585.00
LY410889 Transient overexpression lysate of chromosome 16 open reading frame 59 (C16orf59) (as WB positive control) 100 ug
$436.00

Other products for "TEDC2 or NM_025108"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205814
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC205814 protein sequence
Red=Cloning site Green=Tags(s)

MLPAGCSRRLVAELQGALDACAQRQLQLEQSLRVCRRLLHAWEPTGTRALKPPPGPETNGEDPLPACTPS
PQDLKELEFLTQALEKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTK
GLRQTTVPAKGHPERRLLSVGDGTRVGMGARTPRPGAGLRDQQMAPSAAPQAPEAFTLKEKGHLLRLPAA
FRKAASQNSSLWAQLSSTQTSDSTDAAAAKTQFLQNMQTASGGPQPRLSAVEVEAEAGRLRKACSLLRLR
MREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAVAEQPPRPCPVGRPPGASPSCGGRAEPA
WSPQLLVYSSTQELQTLAALKLRVAVLDQQIHLEKVLMAELLPLVSAAQPQGPPWLALCRAVHSLLCEGG
ARVLTILRDEPAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079384
RefSeq Size 1650
RefSeq ORF 1299
Synonyms C16orf59
Locus ID 80178
UniProt ID Q7L2K0
Cytogenetics 16p13.3
Summary Acts as a positive regulator of ciliary hedgehog signaling. Required for centriole stability.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TEDC2" proteins (3)
SKU Description Size Price
LC410889 Lyophilized C16orf59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410889 Transient overexpression lysate of chromosome 16 open reading frame 59 (C16orf59) (as WB positive control) 100 ug
$436.00
TP305814 Recombinant protein of human chromosome 16 open reading frame 59 (C16orf59), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products