OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CALML3 (NM_005185) Human Mass Spec Standard

Be the first to review this product
SKU
PH305791
CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358130 CALML3 Antibody - middle region
100 ul
$585.00
LY417458 Transient overexpression lysate of calmodulin-like 3 (CALML3) (as WB positive control) 100 ug
$436.00

Other products for "CALML3 or NM_005185"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205791
Predicted MW 16.9 kDa
Protein Sequence
Protein Sequence
>RC205791 protein sequence
Red=Cloning site Green=Tags(s)

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL
GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE
EFVRVLVSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005176
RefSeq Size 1417
RefSeq ORF 447
Synonyms CLP
Locus ID 810
UniProt ID P27482
Cytogenetics 10p15.1
Summary May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.UniProtKB/Swiss-Prot Function
Protein Pathways Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CALML3" proteins (3)
SKU Description Size Price
LC417458 Lyophilized CALML3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417458 Transient overexpression lysate of calmodulin-like 3 (CALML3) (as WB positive control) 100 ug
$436.00
TP305791 Recombinant protein of human calmodulin-like 3 (CALML3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products