OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ENO3 (NM_053013) Human Mass Spec Standard

Be the first to review this product
SKU
PH305684
ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_443739)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY434201 Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "ENO3 or NM_053013"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205684
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC205684 protein sequence
Red=Cloning site Green=Tags(s)

MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
STLGPALLQKKLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGN
PDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDE
GGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY
KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSV
TESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK
AIFAGRKFRNPKAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443739
RefSeq Size 1494
RefSeq ORF 1302
Synonyms GSD13; MSE
Locus ID 2027
UniProt ID P13929
Cytogenetics 17p13.2
Summary This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described.provided by RefSeq, Jul 2010
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ENO3" proteins (9)
SKU Description Size Price
PH319257 ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_001967) 10 ug
$3,360.00
LC409322 Lyophilized ENO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419609 Lyophilized ENO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434201 Lyophilized ENO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409322 Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419609 Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY434201 Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305684 Recombinant protein of human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 20 µg 20 ug
$867.00
TP319257 Recombinant protein of human enolase 3 (beta, muscle) (ENO3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products