OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYDC1 (NM_138812) Human Mass Spec Standard

Be the first to review this product
SKU
PH305409
DYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_620167)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA311571 Goat Anti-DYDC1 (aa142-154) Antibody
100 ug
$565.00
LY408497 Transient overexpression lysate of DPY30 domain containing 1 (DYDC1) (as WB positive control) 100 ug
$436.00

Other products for "DYDC1 or NM_138812"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205409
Predicted MW 20.9 kDa
Protein Sequence
Protein Sequence
>RC205409 protein sequence
Red=Cloning site Green=Tags(s)

MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEM
MERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSG
KTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620167
RefSeq Size 787
RefSeq ORF 531
Synonyms DPY30D1
Locus ID 143241
UniProt ID Q8WWB3
Cytogenetics 10q23.1
Summary This gene encodes a member of a family of proteins that contains a DPY30 domain. The encoded protein is involved in acrosome formation during spermatid development. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jun 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYDC1" proteins (3)
SKU Description Size Price
LC408497 Lyophilized DYDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408497 Transient overexpression lysate of DPY30 domain containing 1 (DYDC1) (as WB positive control) 100 ug
$436.00
TP305409 Recombinant protein of human DPY30 domain containing 1 (DYDC1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products