OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RIT2 (NM_002930) Human Mass Spec Standard

Be the first to review this product
SKU
PH305367
RIT2 MS Standard C13 and N15-labeled recombinant protein (NP_002921)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501704 Anti-RIT2 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5) 100 ul
$447.00
LY401022 Transient overexpression lysate of Ras-like without CAAX 2 (RIT2) (as WB positive control) 100 ug
$436.00

Other products for "RIT2 or NM_002930"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205367
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC205367 protein sequence
Red=Cloning site Green=Tags(s)

MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYL
DILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQF
RQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLK
KKRENMT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002921
RefSeq Size 1102
RefSeq ORF 651
Synonyms RIBA; RIN; ROC2
Locus ID 6014
UniProt ID Q99578
Cytogenetics 18q12.3
Summary RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 PubMed 10545207).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RIT2" proteins (3)
SKU Description Size Price
LC401022 Lyophilized RIT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401022 Transient overexpression lysate of Ras-like without CAAX 2 (RIT2) (as WB positive control) 100 ug
$436.00
TP305367 Recombinant protein of human Ras-like without CAAX 2 (RIT2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products