OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STCH (HSPA13) (NM_006948) Human Mass Spec Standard

Be the first to review this product
SKU
PH305259
HSPA13 MS Standard C13 and N15-labeled recombinant protein (NP_008879)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366651 HSPA13 rabbit polyclonal antibody
100 ul
$310.00
LY402066 Transient overexpression lysate of heat shock protein 70kDa family, member 13 (HSPA13) (as WB positive control) 100 ug
$436.00

Other products for "STCH or NM_006948"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205259
Predicted MW 52 kDa
Protein Sequence
Protein Sequence
>RC205259 protein sequence
Red=Cloning site Green=Tags(s)

MAREMTILGSAVLTLLLAGYLAQQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSM
VSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETI
TVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMA
YGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPS
RKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLS
DKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE
FFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008879
RefSeq Size 4001
RefSeq ORF 1413
Synonyms STCH
Locus ID 6782
UniProt ID P48723
Cytogenetics 21q11.2
Summary The protein encoded by this gene is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatured or incorrectly-folded proteins. The encoded protein contains an ATPase domain and has been shown to associate with a ubiquitin-like protein. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STCH" proteins (3)
SKU Description Size Price
LC402066 Lyophilized HSPA13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402066 Transient overexpression lysate of heat shock protein 70kDa family, member 13 (HSPA13) (as WB positive control) 100 ug
$436.00
TP305259 Recombinant protein of human heat shock protein 70kDa family, member 13 (HSPA13), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products