CRHBP (NM_001882) Human Mass Spec Standard

CAT#: PH305258

CRHBP MS Standard C13 and N15-labeled recombinant protein (NP_001873)

Product Images

Coomassie blue staining of purified CRHBP protein (Cat# TP305258). The protein was produced from HEK293T cells transfected with CRHBP cDNA clone (Cat# RC205258) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205258
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC205258 representing NM_001882
  Red=Cloning site Green=Tags(s)
  
  MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF
  TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF
  CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII
  YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT
  VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001873
• RefSeq Size: 1854
• RefSeq ORF: 966
• Synonyms: CRF-BP; CRFBP
• Locus ID: 1393
• UniProt ID: P24387
• Cytogenetics: 5q13.3
• Summary: Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]