OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HPCAL4 (NM_016257) Human Mass Spec Standard

Be the first to review this product
SKU
PH305253
HPCAL4 MS Standard C13 and N15-labeled recombinant protein (NP_057341)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808692 HPCAL4 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11) 100 ul
$447.00
LY414097 Transient overexpression lysate of hippocalcin like 4 (HPCAL4) (as WB positive control) 100 ug
$436.00

Other products for "HPCAL4 or NM_016257"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205253
Predicted MW 22.2 kDa
Protein Sequence
Protein Sequence
>RC205253 protein sequence
Red=Cloning site Green=Tags(s)

MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR
TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM
NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057341
RefSeq Size 4895
RefSeq ORF 573
Synonyms HLP4
Locus ID 51440
UniProt ID Q9UM19
Cytogenetics 1p34.2
Summary The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Sep 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HPCAL4" proteins (3)
SKU Description Size Price
LC414097 Lyophilized HPCAL4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414097 Transient overexpression lysate of hippocalcin like 4 (HPCAL4) (as WB positive control) 100 ug
$436.00
TP305253 Recombinant protein of human hippocalcin like 4 (HPCAL4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products